Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNG2 Peptide - C-terminal region

KCNG2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KCNF2, KV6.2

UniProt

Q9UJ96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036415.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQRAASPEPALQEDST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2'-Dithiobisbenzoic Acid
TRC-D493990-1G 1 g

2,2'-Dithiobisbenzoic Acid

Sign In for Pricing
View Details
HIPK4 Antibody
8C11365-AAT 50 µg

HIPK4 Antibody

Sign In for Pricing
View Details
(±)-2-Pentanol
TRC-P227105-250ML 250 mL

(±)-2-Pentanol

Sign In for Pricing
View Details
CRISP2 (NM_001142408) Human Over-expression Lysate
LC428075 20 µg

CRISP2 (NM_001142408) Human Over-expression Lysate

Sign In for Pricing
View Details
Human HDAC7 activation kit by CRISPRa
GA109877 1 Kit

Human HDAC7 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501732 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details