Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNG2 Peptide - C-terminal region

KCNG2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KCNF2, KV6.2

UniProt

Q9UJ96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036415.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQRAASPEPALQEDST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPA Rabbit Monoclonal Antibody [Clone ID: R04-9A5]
TA421793 100 µL

CENPA Rabbit Monoclonal Antibody [Clone ID: R04-9A5]

Sign In for Pricing
View Details
SETD7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E3]
TA503377AM 100 µL

SETD7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E3]

Sign In for Pricing
View Details
Zirconyl Hydroxide
TRC-Z485055-2.5G 2.5 g

Zirconyl Hydroxide

Sign In for Pricing
View Details
Human Calcyon (CALY) activation kit by CRISPRa
GA109437 1 Kit

Human Calcyon (CALY) activation kit by CRISPRa

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1845), Biotin conjugate, 0.1mg/mL
BNCB1845-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/1845), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MARCO Recombinant Rabbit monoclonal Antibody
HA750940 100 µL

MARCO Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details