Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS8 Peptide - C-terminal region

COPS8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COP9, CSN8, SGN8

UniProt

Q99627

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006701.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ACADM Antibody
RC-5601-01 50 μL

Recombinant ACADM Antibody

Sign In for Pricing
View Details
Recombinant ACADM Antibody
RC-5601-02 100 µL

Recombinant ACADM Antibody

Sign In for Pricing
View Details
Recombinant ACADM Antibody
RC-5601-03 1 mL

Recombinant ACADM Antibody

Sign In for Pricing
View Details
Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: 1E7]
AM26639AF-N 100 µg

Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: 1E7]

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), CF647 conjugate, 0.1mg/mL
BNC472353-500 1x 500 µL

Calcineurin A / PPP3CA (CALNA/2353), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NIRF (UHRF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E10]
TA810202AM 100 µL

NIRF (UHRF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E10]

Sign In for Pricing
View Details