Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS8 Peptide - C-terminal region

COPS8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COP9, CSN8, SGN8

UniProt

Q99627

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006701.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR133 (ADGRD1) Human qPCR Primer Pair (NM_198827)
HP219439 200 Reactions

GPR133 (ADGRD1) Human qPCR Primer Pair (NM_198827)

Sign In for Pricing
View Details
STAT3 Polyclonal Antibody
E-AB-32981-01 20 µL

STAT3 Polyclonal Antibody

Sign In for Pricing
View Details
STAT3 Polyclonal Antibody
E-AB-32981-02 60 µL

STAT3 Polyclonal Antibody

Sign In for Pricing
View Details
STAT3 Polyclonal Antibody
E-AB-32981-03 120 µL

STAT3 Polyclonal Antibody

Sign In for Pricing
View Details
STAT3 Polyclonal Antibody
E-AB-32981-04 200 µL

STAT3 Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human BMG/β2-MG (Beta-2-Microglobulin) ELISA Kit
E-UNEL-H0005-01 5x 96 Tests

Uncoated Human BMG/β2-MG (Beta-2-Microglobulin) ELISA Kit

Sign In for Pricing
View Details