Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGK Peptide - middle region

PIGK Peptide - middle region

Product Specifications

Product Name Alternative

GPI8

UniProt

Q92643

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005473.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human TRPC5 pAb
PA4695-01 50 μL

Rabbit Anti-Human TRPC5 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TRPC5 pAb
PA4695-02 100 μL

Rabbit Anti-Human TRPC5 pAb

Sign In for Pricing
View Details
IL-1beta BioAssayTM ELISA Kit (Rat) (Interleukin-1 beta, IL-1 beta, Catabolin, IL1B, IL1F2, IL-1beta, IL1beta) discontinued
360500 48 Tests

IL-1beta BioAssayTM ELISA Kit (Rat) (Interleukin-1 beta, IL-1 beta, Catabolin, IL1B, IL1F2, IL-1beta, IL1beta) discontinued

Sign In for Pricing
View Details
Human OxHDL (Oxidized high-density lipoprotein) ELISA Kit
EK248501 96 Well

Human OxHDL (Oxidized high-density lipoprotein) ELISA Kit

Sign In for Pricing
View Details
RpsJ Antibody
orb827703 2 mg

RpsJ Antibody

Sign In for Pricing
View Details
Whirl-Pak® Filter Bags -
1462053 250 PK

Whirl-Pak® Filter Bags -

Sign In for Pricing
View Details