What is the catalog number for PIGK Peptide - middle region?

The catalog number for PIGK Peptide - middle region is orb1999094.

What sizes are available for PIGK Peptide - middle region?

PIGK Peptide - middle region is available in the following size(s): 100 µg.

Is PIGK Peptide - middle region in stock?

PIGK Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PIGK Peptide - middle region

Product Specifications

Product Name Alternative

GPI8

UniProt

Q92643

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005473.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E45H17447-2 20 µg

MARK4 (NM_031417) Human Over-expression Lysate

Sign In for Pricing

View Details

EMG0291 96 Tests

Mouse GTF2F1 ELISA Kit

Sign In for Pricing

View Details

FAB27381X 0.1 mL

Mouse Monoclonal CD27 Ligand/TNFSF7/CD70 Antibody (832614) [Alexa Fluor 532]

Sign In for Pricing

View Details

1214659 15 PK

Tygon Tube 3350, 15.90 x 2.40 mm

Sign In for Pricing

View Details

QM39130S 200 Tests

Mouse Ggnbp1 qPCR Primer Pair

Sign In for Pricing

View Details

PV087690 500 ng

INSC Protein Vector (Human) (pPB-C-His)

Sign In for Pricing

View Details