What is the catalog number for CDC42EP1 Peptide - N-terminal region?

The catalog number for CDC42EP1 Peptide - N-terminal region is orb1999093.

What sizes are available for CDC42EP1 Peptide - N-terminal region?

CDC42EP1 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is CDC42EP1 Peptide - N-terminal region in stock?

CDC42EP1 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

CDC42EP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CEP1, BORG5, MSE55

UniProt

Q00587

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_689449.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

38548036 100 µg

RASL11B Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing

View Details

PV031747 500 ng

PLK2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing

View Details

MBS1490254-01 0.05 mg

Rabbit anti-Escherichia coli DNA ligase polyclonal Antibody, HRP conjugated

Sign In for Pricing

View Details

MBS1490254-02 0.1 mg

Rabbit anti-Escherichia coli DNA ligase polyclonal Antibody, HRP conjugated

Sign In for Pricing

View Details

MBS1490254-03 5x 0.1 mg

Rabbit anti-Escherichia coli DNA ligase polyclonal Antibody, HRP conjugated

Sign In for Pricing

View Details

abx028296-01 80 µL

Mouse Stk32b Antibody

Sign In for Pricing

View Details