Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMCH1 Peptide - middle region

LIMCH1 Peptide - middle region

Product Specifications

Product Name Alternative

LMO7B, LIMCH1A

UniProt

Q9UPQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001106188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RDSGYIDCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSRQTPSPDVVLRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human recombinant IFN omega (interferon omega) protein, AF
PROTP05000-3-500ug 500 µg

Human recombinant IFN omega (interferon omega) protein, AF

Sign In for Pricing
View Details
ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (HRP)
MBS6180748-01 0.1 mL

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (HRP)

Sign In for Pricing
View Details
ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (HRP)
MBS6180748-02 5x 0.1 mL

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (HRP)

Sign In for Pricing
View Details
Chicken (Immunoglobulin Y) ELISA Kit
MBS7254645-01 48 Well

Chicken (Immunoglobulin Y) ELISA Kit

Sign In for Pricing
View Details
Chicken (Immunoglobulin Y) ELISA Kit
MBS7254645-02 96 Well

Chicken (Immunoglobulin Y) ELISA Kit

Sign In for Pricing
View Details
Chicken (Immunoglobulin Y) ELISA Kit
MBS7254645-03 5x 96 Well

Chicken (Immunoglobulin Y) ELISA Kit

Sign In for Pricing
View Details