Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMCH1 Peptide - middle region

LIMCH1 Peptide - middle region

Product Specifications

Product Name Alternative

LMO7B, LIMCH1A

UniProt

Q9UPQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001106188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RDSGYIDCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSRQTPSPDVVLRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCAF (K (Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (FITC)
249813-FITC 100 µL

PCAF (K (Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (FITC)

Sign In for Pricing
View Details
Progesterone Receptor Antibody (IHC Gold)
MBS8580248-01 0.1 mL

Progesterone Receptor Antibody (IHC Gold)

Sign In for Pricing
View Details
Progesterone Receptor Antibody (IHC Gold)
MBS8580248-02 0.1 mL (AF635)

Progesterone Receptor Antibody (IHC Gold)

Sign In for Pricing
View Details
Progesterone Receptor Antibody (IHC Gold)
MBS8580248-03 0.1 mL (AF610)

Progesterone Receptor Antibody (IHC Gold)

Sign In for Pricing
View Details
Progesterone Receptor Antibody (IHC Gold)
MBS8580248-04 0.1 mL (AF405S)

Progesterone Receptor Antibody (IHC Gold)

Sign In for Pricing
View Details
Progesterone Receptor Antibody (IHC Gold)
MBS8580248-05 0.1 mL (AF405L)

Progesterone Receptor Antibody (IHC Gold)

Sign In for Pricing
View Details