PSME4 Peptide - C-terminal region
PSME4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PA200
UniProt
Q14997
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_055429.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV729538 1.0 µg DNA
IGHV3-30-5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
MBS2166693-01 0.1 mL
Cy3-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
Sign In for Pricing
View Details MBS2166693-02 0.2 mL
Cy3-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
Sign In for Pricing
View Details MBS2166693-03 0.5 mL
Cy3-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
Sign In for Pricing
View Details MBS2166693-04 1 mL
Cy3-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
Sign In for Pricing
View Details