Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSME4 Peptide - C-terminal region

PSME4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PA200

UniProt

Q14997

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055429.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP4F5 Adenovirus (Rat)
17515056 1.0 mL

CYP4F5 Adenovirus (Rat)

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (DE-K10), 0.2mg/mL
BNUB1273-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (DE-K10), 0.2mg/mL

Sign In for Pricing
View Details
NRG1 Rabbit Polyclonal Antibody (FITC)
orb2116245 100 µL

NRG1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
PLV3-U6-STK32A-shRNA1-EGFP-Neo Plasmid
PVT80422 2 µg

PLV3-U6-STK32A-shRNA1-EGFP-Neo Plasmid

Sign In for Pricing
View Details
JMJD2A Antibody [B12L5]
F0785-100uL*2 2x 100 μL

JMJD2A Antibody [B12L5]

Sign In for Pricing
View Details
CDX2 Peptide
AF4089-BP 1 mg

CDX2 Peptide

Sign In for Pricing
View Details