Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Peptide - C-terminal region

TWF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A6r, A6RP, PTK9L, MSTP011

UniProt

Q6IBS0

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009215.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKIEIGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lung Specific Antigen (LSA120), CF647 conjugate, 0.1mg/mL
BNC470120-100 1x 100 µL

Lung Specific Antigen (LSA120), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl Glycodeoxycholate
TRC-E918385-25MG 25 mg

Ethyl Glycodeoxycholate

Sign In for Pricing
View Details
2-Hydroxybutanoic Acid
TRC-H831185-2.5G 2.5 g

2-Hydroxybutanoic Acid

Sign In for Pricing
View Details
PTP epsilon (PTPRE) Human Gene Knockout Kit (CRISPR)
KN207950LP 1 Kit

PTP epsilon (PTPRE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pxmp4 (NM_021534) Mouse Tagged ORF Clone
MG202304 10 µg

Pxmp4 (NM_021534) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
L-Threonic Acid Calcium Salt
TRC-T404990-25G 25 g

L-Threonic Acid Calcium Salt

Sign In for Pricing
View Details