Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Peptide - C-terminal region

TWF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A6r, A6RP, PTK9L, MSTP011

UniProt

Q6IBS0

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009215.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKIEIGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5C (Center) Rabbit Polyclonal Antibody
AP17822PU-N 400 µL

UNC5C (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ferritin Conjugated Lens culinaris Lectin (Lentil) -LcH-
I-1401-1 1 mg

Ferritin Conjugated Lens culinaris Lectin (Lentil) -LcH-

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700012 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Linoleic Acid
TRC-L467495-50MG 50 mg

Linoleic Acid

Sign In for Pricing
View Details
6-Chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridine-3-acetonitrile
TRC-C365630-25MG 25 mg

6-Chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridine-3-acetonitrile

Sign In for Pricing
View Details
CD95 / FAS / TNFRSF6 (FAS/3112), CF640R conjugate, 0.1mg/mL
BNC403112-500 1x 500 µL

CD95 / FAS / TNFRSF6 (FAS/3112), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details