Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1RL Peptide - middle region

C1RL Peptide - middle region

Product Specifications

Product Name Alternative

C1RL1, C1RLP, CLSPa, C1r-LP

UniProt

Q9NZP8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001284569.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNQSVNVFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHNFSGDIALLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Toll-like receptor 9 antibody (biotin)
MBS834496-01 0.025 mg

Toll-like receptor 9 antibody (biotin)

Sign In for Pricing
View Details
Toll-like receptor 9 antibody (biotin)
MBS834496-02 0.05 mg

Toll-like receptor 9 antibody (biotin)

Sign In for Pricing
View Details
Toll-like receptor 9 antibody (biotin)
MBS834496-03 5x 0.05 mg

Toll-like receptor 9 antibody (biotin)

Sign In for Pricing
View Details
MLH1 Monoclonal Antibody
BT-MCA3764-01 50 µL

MLH1 Monoclonal Antibody

Sign In for Pricing
View Details
MLH1 Monoclonal Antibody
BT-MCA3764-02 100 µL

MLH1 Monoclonal Antibody

Sign In for Pricing
View Details
2-Amino-N- (but-2-yl) benzamide
OR21223 1 Each

2-Amino-N- (but-2-yl) benzamide

Sign In for Pricing
View Details