Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL48 Peptide - C-terminal region

MRPL48 Peptide - C-terminal region

Product Specifications

Product Name Alternative

L48MT, CGI-118, HSPC290, MRP-L48

UniProt

Q96GC5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057139.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PD-1 Antibody-PE (5M150)
TMAY-00718P-01 25 Tests

Anti-PD-1 Antibody-PE (5M150)

Sign In for Pricing
View Details
Anti-PD-1 Antibody-PE (5M150)
TMAY-00718P-02 100 Tests

Anti-PD-1 Antibody-PE (5M150)

Sign In for Pricing
View Details
Human ADRbK1 (Adrenergic Receptor Beta Kinase 1) ELISA Kit
EK244118 96 Well

Human ADRbK1 (Adrenergic Receptor Beta Kinase 1) ELISA Kit

Sign In for Pricing
View Details
CAMK2G Rabbit pAb
A21668-01 20 µL

CAMK2G Rabbit pAb

Sign In for Pricing
View Details
CAMK2G Rabbit pAb
A21668-02 100 μL

CAMK2G Rabbit pAb

Sign In for Pricing
View Details
CAMK2G Rabbit pAb
A21668-03 500 μL

CAMK2G Rabbit pAb

Sign In for Pricing
View Details