What is the catalog number for MRPL48 Peptide - C-terminal region?

The catalog number for MRPL48 Peptide - C-terminal region is orb1999074.

What sizes are available for MRPL48 Peptide - C-terminal region?

MRPL48 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MRPL48 Peptide - C-terminal region in stock?

MRPL48 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MRPL48 Peptide - C-terminal region

Product Specifications

Product Name Alternative

L48MT, CGI-118, HSPC290, MRP-L48

UniProt

Q96GC5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057139.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20R-1518 100 ug

Cytochrome c antibody

Sign In for Pricing

View Details

TU050417 1.0 mL

ADTB1L1 3'UTR GFP Stable Cell Line

Sign In for Pricing

View Details

YP-W11057-01 48 Tests

Human ovalbumin specific IgE (OVA-sIgE) ELISA Kit

Sign In for Pricing

View Details

YP-W11057-02 96 Tests

Human ovalbumin specific IgE (OVA-sIgE) ELISA Kit

Sign In for Pricing

View Details

NBP3-08786PE 100 µL

Mouse Monoclonal TIF1 alpha Antibody (PCRP-TRIM24-1B12) [PE]

Sign In for Pricing

View Details

orb2309750-01 20 µg

L1TD1 Antibody

Sign In for Pricing

View Details