Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEH1L Peptide - middle region

SEH1L Peptide - middle region

Product Specifications

Product Name Alternative

Seh1, SEH1A, SEH1B, SEC13L

UniProt

Q96EE3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001013455.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Pentraxin 3
IT-010-029M3-01 0.1 mg

Anti-Human Pentraxin 3

Sign In for Pricing
View Details
Anti-Human Pentraxin 3
IT-010-029M3-02 0.5 mg

Anti-Human Pentraxin 3

Sign In for Pricing
View Details
Anti-eIF3B Antibody Picoband®, HRP Conjugate
PA2030-HRP 100 µg/Vial

Anti-eIF3B Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Tri-Sodium citrate dihydrate p.A.
LC-6875.3 500 g

Tri-Sodium citrate dihydrate p.A.

Sign In for Pricing
View Details
GGT5 (F-8) HRP
sc-373693 HRP 200 µg/mL

GGT5 (F-8) HRP

Sign In for Pricing
View Details
SGT1/ECD Rabbit Polyclonal Antibody
MBS8596857-01 0.1 mg

SGT1/ECD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details