Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPSAP1 Peptide - middle region

PRPSAP1 Peptide - middle region

Product Specifications

Product Name Alternative

PAP39

UniProt

Q14558

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002757.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI5C10]
M04969 100 µL

Anti-GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI5C10]

Sign In for Pricing
View Details
ELISA kit for Mouse PTHR2 (Parathyroid Hormone Receptor 2)
E-EL-M0881 96 Tests

ELISA kit for Mouse PTHR2 (Parathyroid Hormone Receptor 2)

Sign In for Pricing
View Details
TIM3 discontinued
381496 200 µL

TIM3 discontinued

Sign In for Pricing
View Details
Rat Ltv1 Pre-designed siRNA Set A
SI207915A 1 Each

Rat Ltv1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FUK Antibody (HRP)
orb418340-01 50 µg

FUK Antibody (HRP)

Sign In for Pricing
View Details
FUK Antibody (HRP)
orb418340-02 100 µg

FUK Antibody (HRP)

Sign In for Pricing
View Details