PRPSAP1 Peptide - middle region
PRPSAP1 Peptide - middle region
Product Specifications
Product Name Alternative
PAP39
UniProt
Q14558
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002757.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7222663-01 48 Well
Monkey Cysteine-rich with EGF-like domain protein 2 (CRELD2) ELISA Kit
Sign In for Pricing
View Details MBS7222663-02 96 Well
Monkey Cysteine-rich with EGF-like domain protein 2 (CRELD2) ELISA Kit
Sign In for Pricing
View Details MBS7222663-03 5x 96 Well
Monkey Cysteine-rich with EGF-like domain protein 2 (CRELD2) ELISA Kit
Sign In for Pricing
View Details MBS7222663-04 10x 96 Well
Monkey Cysteine-rich with EGF-like domain protein 2 (CRELD2) ELISA Kit
Sign In for Pricing
View Details MBS6283247-01 0.2 mL
CD40, CT (CD40, TNFRSF5, Tumor necrosis factor receptor superfamily member 5, B Cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40) (AP)
Sign In for Pricing
View Details MBS6283247-02 5x 0.2 mL
CD40, CT (CD40, TNFRSF5, Tumor necrosis factor receptor superfamily member 5, B Cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40) (AP)
Sign In for Pricing
View Details