Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17ORF75 Peptide - N-terminal region

C17ORF75 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NJMU-R1

UniProt

Q9HAS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071739.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLQESMDGDEKELESSEEGGSAEERRLEPPSSSHYCLYSYRGSRLAQQRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-100 1x 100 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL
BNC401505-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL
BNC880532-100 1x 100 µL

Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DG1/447), CF594 conjugate, 0.1mg/mL
BNC940447-100 1x 100 µL

DOG-1 (DG1/447), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details