Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM50A Peptide - C-terminal region

FAM50A Peptide - C-terminal region

Product Specifications

Product Name Alternative

9F, XAP5, HXC26, HXC-26, DXS9928E

UniProt

Q14320

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004690.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD200R1L (NM_001008784) Human Over-expression Lysate
LY423379 100 µg

CD200R1L (NM_001008784) Human Over-expression Lysate

Sign In for Pricing
View Details
ARHGAP22 (NM_021226) Human Recombinant Protein
TP320614M 100 µg

ARHGAP22 (NM_021226) Human Recombinant Protein

Sign In for Pricing
View Details
PE/Cyanine5 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842G-01 20 Tests

PE/Cyanine5 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
PE/Cyanine5 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842G-02 100 Tests

PE/Cyanine5 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
PE/Cyanine5 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842G-03 2x 100 Tests

PE/Cyanine5 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Phosphatidic acid phosphatase type 2B (PLPP3) (NM_003713) Human Recombinant Protein
TP303480L 1 mg

Phosphatidic acid phosphatase type 2B (PLPP3) (NM_003713) Human Recombinant Protein

Sign In for Pricing
View Details