Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM50A Peptide - C-terminal region

FAM50A Peptide - C-terminal region

Product Specifications

Product Name Alternative

9F, XAP5, HXC26, HXC-26, DXS9928E

UniProt

Q14320

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004690.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIA1 (NM_001114183) Human Recombinant Protein
TP326253 20 µg

GRIA1 (NM_001114183) Human Recombinant Protein

Sign In for Pricing
View Details
Rat DKK1 Antibody Pair Set
E-KAB-0637 50 µL & 100 µg

Rat DKK1 Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS624885 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
HOXA2 (NM_006735) Human Over-expression Lysate
LC402018 20 µg

HOXA2 (NM_006735) Human Over-expression Lysate

Sign In for Pricing
View Details
TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF568 conjugate, 0.1mg/mL
BNC682770-100 1x 100 µL

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trypsin (PRSS3) (NM_001197098) Human Over-expression Lysate
LY434086 100 µg

Trypsin (PRSS3) (NM_001197098) Human Over-expression Lysate

Sign In for Pricing
View Details