What is the catalog number for INPP5K Peptide - middle region?

The catalog number for INPP5K Peptide - middle region is orb1999069.

What sizes are available for INPP5K Peptide - middle region?

INPP5K Peptide - middle region is available in the following size(s): 100 µg.

Is INPP5K Peptide - middle region in stock?

INPP5K Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

INPP5K Peptide - middle region

Product Specifications

Product Name Alternative

PPS, SKIP

UniProt

Q9BT40

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129114.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS6361072-01 0.2 mL

UCK1, CT (UCK1, URK1, Uridine-cytidine kinase 1, Cytidine monophosphokinase 1, Uridine monophosphokinase 1) (FITC)

Sign In for Pricing

View Details

MBS6361072-02 5x 0.2 mL

UCK1, CT (UCK1, URK1, Uridine-cytidine kinase 1, Cytidine monophosphokinase 1, Uridine monophosphokinase 1) (FITC)

Sign In for Pricing

View Details

NBP3-06345AF532 0.1 mL

Rabbit Polyclonal DNA Polymerase gamma Antibody [Alexa Fluor 532]

Sign In for Pricing

View Details

sc-405798 20 µg

pICln CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing

View Details

C06545-100uL 100 µL

Zyxin Rabbit mAb

Sign In for Pricing

View Details

NBP2-74406H 0.1 mL

Mouse Monoclonal STK39 Antibody (OTI4E3) [HRP]

Sign In for Pricing

View Details