Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5K Peptide - middle region

INPP5K Peptide - middle region

Product Specifications

Product Name Alternative

PPS, SKIP

UniProt

Q9BT40

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129114.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL6 Recombinant Antibody, Cy3 Conjugated
bsm-60223R-Cy3 100 µL

BCL6 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Human Putative peptide YY-3 (PYY3)
MBS1394296-01 0.02 mg (E-Coli)

Recombinant Human Putative peptide YY-3 (PYY3)

Sign In for Pricing
View Details
Recombinant Human Putative peptide YY-3 (PYY3)
MBS1394296-02 0.1 mg (E-Coli)

Recombinant Human Putative peptide YY-3 (PYY3)

Sign In for Pricing
View Details
Recombinant Human Putative peptide YY-3 (PYY3)
MBS1394296-03 0.02 mg (Yeast)

Recombinant Human Putative peptide YY-3 (PYY3)

Sign In for Pricing
View Details
Recombinant Human Putative peptide YY-3 (PYY3)
MBS1394296-04 0.1 mg (Yeast)

Recombinant Human Putative peptide YY-3 (PYY3)

Sign In for Pricing
View Details
Recombinant Human Putative peptide YY-3 (PYY3)
MBS1394296-05 0.02 mg (Baculovirus)

Recombinant Human Putative peptide YY-3 (PYY3)

Sign In for Pricing
View Details