Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPT1 Peptide - middle region

LIPT1 Peptide - middle region

Product Specifications

Product Name Alternative

LIPT1D

UniProt

Q9Y234

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191759.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NDVYQNLAVEDWIHDHMNLEGKPILFFWQNSPSVVIGRHQNPWQECNLNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-4R Recombinant Rabbit monoclonal Antibody
HA723336 100 µL

Human IL-4R Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (C-43), CF488A conjugate, 0.1mg/mL
BNC880688-100 1x 100 µL

Cytokeratin 8 (C-43), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-Muricholic Acid Glucuronide Conjugate 4
TRC-M234673-5MG 5 mg

Beta-Muricholic Acid Glucuronide Conjugate 4

Sign In for Pricing
View Details
Hydrotalcite, synthetic
TRC-H714835-50G 50 g

Hydrotalcite, synthetic

Sign In for Pricing
View Details
FITC Anti-Human CD146 Antibody[AA98]
E-AB-F1417C-01 20 Tests

FITC Anti-Human CD146 Antibody[AA98]

Sign In for Pricing
View Details
FITC Anti-Human CD146 Antibody[AA98]
E-AB-F1417C-02 100 Tests

FITC Anti-Human CD146 Antibody[AA98]

Sign In for Pricing
View Details