Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPT1 Peptide - middle region

LIPT1 Peptide - middle region

Product Specifications

Product Name Alternative

LIPT1D

UniProt

Q9Y234

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191759.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NDVYQNLAVEDWIHDHMNLEGKPILFFWQNSPSVVIGRHQNPWQECNLNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Art2a activation kit by CRISPRa
GA200287 1 Kit

Mouse Art2a activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), 1mg/mL
BNUM1707-50 1x 50 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), 1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), 0.2mg/mL
BNUB1950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), 0.2mg/mL

Sign In for Pricing
View Details
2-Chlorophenyl Cyclopentyl-d9 Ketone
TRC-C377822-25MG 25 mg

2-Chlorophenyl Cyclopentyl-d9 Ketone

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI10H3]
CF806730 100 µg

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI10H3]

Sign In for Pricing
View Details
SKOR2 (C-term) Rabbit Polyclonal Antibody
AP51736PU-N 400 µL

SKOR2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details