Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNDC3B Peptide - middle region

RUNDC3B Peptide - middle region

Product Specifications

Product Name Alternative

RPIB9, RPIP9

UniProt

Q96NL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001127877.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFCLKGEGLDGSFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcl1b4 Mouse Gene Knockout Kit (CRISPR)
KN517339 1 Kit

Tcl1b4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: B-B38]
AM31184FC-N 1 mL (100 Tests)

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: B-B38]

Sign In for Pricing
View Details
GCIP interacting protein p29 (SYF2) (NM_207170) Human Over-expression Lysate
LC404061 20 µg

GCIP interacting protein p29 (SYF2) (NM_207170) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti Human VPS18 Polyclonal
Y054996 100 µL

Anti Human VPS18 Polyclonal

Sign In for Pricing
View Details
DAP3 Human Gene Knockout Kit (CRISPR)
KN419744 1 Kit

DAP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Feruloylputrescine Trifluoroacetic Acid Salt
TRC-F308950-1G 1 g

Feruloylputrescine Trifluoroacetic Acid Salt

Sign In for Pricing
View Details