Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNDC3B Peptide - middle region

RUNDC3B Peptide - middle region

Product Specifications

Product Name Alternative

RPIB9, RPIP9

UniProt

Q96NL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001127877.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFCLKGEGLDGSFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trir Mouse Gene Knockout Kit (CRISPR)
KN500240 1 Kit

Trir Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Nitroso Nipecotic Acid-d4 (Major)
TRC-N532002-1MG 1 mg

N-Nitroso Nipecotic Acid-d4 (Major)

Sign In for Pricing
View Details
CAMK1D Polyclonal Antibody
E-AB-14817-01 20 µL

CAMK1D Polyclonal Antibody

Sign In for Pricing
View Details
CAMK1D Polyclonal Antibody
E-AB-14817-02 60 µL

CAMK1D Polyclonal Antibody

Sign In for Pricing
View Details
CAMK1D Polyclonal Antibody
E-AB-14817-03 120 µL

CAMK1D Polyclonal Antibody

Sign In for Pricing
View Details
CAMK1D Polyclonal Antibody
E-AB-14817-04 200 µL

CAMK1D Polyclonal Antibody

Sign In for Pricing
View Details