SDAD1 Peptide - C-terminal region
SDAD1 Peptide - C-terminal region
Product Specifications
UniProt
Q9NVU7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001275912.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKKQKNFMMMRYSQN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7138488 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CDC5 Polyclonal Antibody
Sign In for Pricing
View Details TL510855V 500 µL Each
Tbc1d22a Mouse shRNA Lentiviral Particle (Locus ID 223754)
Sign In for Pricing
View Details 
EP22560 96 Tests
Porcine VCAM1 (Vascular Cell Adhesion Molecule 1) ELISA Kit
Sign In for Pricing
View Details 