Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR4 Peptide - C-terminal region

WDR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRM82, TRMT82

UniProt

P57081

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001247403.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLGAP1 Polyclonal Conjugated Antibody
MBS9439768-01 0.1 mL (Biotin)

DLGAP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DLGAP1 Polyclonal Conjugated Antibody
MBS9439768-02 0.1 mL (AF350)

DLGAP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DLGAP1 Polyclonal Conjugated Antibody
MBS9439768-03 0.1 mL (AF405)

DLGAP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DLGAP1 Polyclonal Conjugated Antibody
MBS9439768-04 0.1 mL (AF488)

DLGAP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DLGAP1 Polyclonal Conjugated Antibody
MBS9439768-05 0.1 mL (AF555)

DLGAP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DLGAP1 Polyclonal Conjugated Antibody
MBS9439768-06 0.1 mL (AF594)

DLGAP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details