What is the catalog number for WDR4 Peptide - C-terminal region?

The catalog number for WDR4 Peptide - C-terminal region is orb1999064.

What sizes are available for WDR4 Peptide - C-terminal region?

WDR4 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is WDR4 Peptide - C-terminal region in stock?

WDR4 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

WDR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRM82, TRMT82

UniProt

P57081

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001247403.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS036848-01 48 Well

Rat B-Cell Cll/Lymphoma 10 ELISA Kit

Sign In for Pricing

View Details

MBS036848-02 96 Well

Rat B-Cell Cll/Lymphoma 10 ELISA Kit

Sign In for Pricing

View Details

MBS036848-03 5x 96 Well

Rat B-Cell Cll/Lymphoma 10 ELISA Kit

Sign In for Pricing

View Details

MBS036848-04 10x 96 Well

Rat B-Cell Cll/Lymphoma 10 ELISA Kit

Sign In for Pricing

View Details

orb2098646 100 µL

ERC1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing

View Details

MBS1458938 Inquire

Recombinant Convallaria majalis Maturase K (matK), partial

Sign In for Pricing

View Details