Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3D19 Peptide - middle region

SH3D19 Peptide - middle region

Product Specifications

Product Name Alternative

EBP, EVE1, Kryn, SH3P19

UniProt

Q5HYK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009555.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKKLPFNRSSSDMDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRPKPGHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome C Oxidase subunit VIc (COX6C) Human Gene Knockout Kit (CRISPR)
KN400374 1 Kit

Cytochrome C Oxidase subunit VIc (COX6C) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRPK (TP53RK) Human Gene Knockout Kit (CRISPR)
KN209748RB 1 Kit

PRPK (TP53RK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NAGLU (NM_000263) Human Over-expression Lysate
LY424833 100 µg

NAGLU (NM_000263) Human Over-expression Lysate

Sign In for Pricing
View Details
Dysferlin (DYSF) (C-term) Rabbit Polyclonal Antibody
AP31052PU-N 250 µL

Dysferlin (DYSF) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fluo -4 AM - Green fluorescent calcium indicator
1041C 500 µg

Fluo -4 AM - Green fluorescent calcium indicator

Sign In for Pricing
View Details
C-Myc Oncoprotein (MYC2895R), CF640R conjugate, 0.1mg/mL
BNC402895-100 1x 100 µL

C-Myc Oncoprotein (MYC2895R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details