Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3D19 Peptide - middle region

SH3D19 Peptide - middle region

Product Specifications

Product Name Alternative

EBP, EVE1, Kryn, SH3P19

UniProt

Q5HYK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009555.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKKLPFNRSSSDMDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRPKPGHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 647 azide
1091-AAT 1 mg

IFluor® 647 azide

Sign In for Pricing
View Details
Recombinant EAAT1 Monoclonal Antibody
AN301072L-01 50 µL

Recombinant EAAT1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant EAAT1 Monoclonal Antibody
AN301072L-02 100 µL

Recombinant EAAT1 Monoclonal Antibody

Sign In for Pricing
View Details
5-Bromopyrimidine
TRC-B686855-25G 25 g

5-Bromopyrimidine

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF488A conjugate, 0.1mg/mL
BNC882430-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein
TP310489 20 µg

Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein

Sign In for Pricing
View Details