Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB6 Peptide - middle region

ASB6 Peptide - middle region

Product Specifications

UniProt

Q9NWX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001189332.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHNTENIRLLLEGGADVKATTKDGDTVFTCIIFLLGETVGGDKEEAQMIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PGC/Gastricsin Monoclonal antibody (12H9)
MBS1567771-01 0.1 mg

Anti-PGC/Gastricsin Monoclonal antibody (12H9)

Sign In for Pricing
View Details
Anti-PGC/Gastricsin Monoclonal antibody (12H9)
MBS1567771-02 5x 0.1 mg

Anti-PGC/Gastricsin Monoclonal antibody (12H9)

Sign In for Pricing
View Details
N-(2-Chloroethyl)benzenesulfonamide
TRC-C867540-2.5G 2.5 g

N-(2-Chloroethyl)benzenesulfonamide

Sign In for Pricing
View Details
LDHA Rabbit mAb
MBS9470846-01 0.05 mL

LDHA Rabbit mAb

Sign In for Pricing
View Details
LDHA Rabbit mAb
MBS9470846-02 0.1 mL

LDHA Rabbit mAb

Sign In for Pricing
View Details
LDHA Rabbit mAb
MBS9470846-03 5x 0.1 mL

LDHA Rabbit mAb

Sign In for Pricing
View Details