Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB6 Peptide - middle region

ASB6 Peptide - middle region

Product Specifications

UniProt

Q9NWX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001189332.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHNTENIRLLLEGGADVKATTKDGDTVFTCIIFLLGETVGGDKEEAQMIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam120a siRNA Oligos set (Mouse)
19735174 3x 5 nmol

Fam120a siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri yejK Protein (aa 1-335)
VAng-Lsx08377-50gEcoli 50 µg (E. coli)

Recombinant Shigella Flexneri yejK Protein (aa 1-335)

Sign In for Pricing
View Details
OR10D3P sgRNA CRISPR Lentivector (Human) (Target 2)
K1551303 1.0 µg DNA

OR10D3P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
NR3C1 Polyclonal Antibody
MBS8568377-01 0.1 mL

NR3C1 Polyclonal Antibody

Sign In for Pricing
View Details
NR3C1 Polyclonal Antibody
MBS8568377-02 0.1 mL (AF405L)

NR3C1 Polyclonal Antibody

Sign In for Pricing
View Details
NR3C1 Polyclonal Antibody
MBS8568377-03 0.1 mL (AF405S)

NR3C1 Polyclonal Antibody

Sign In for Pricing
View Details