Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF7IP2 Peptide - middle region

ATF7IP2 Peptide - middle region

Product Specifications

Product Name Alternative

MCAF2

UniProt

Q5U623

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243089.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPPAPLPELVDKTRDTLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Propanethiol
TRC-P839333-1G 1 g

2-Propanethiol

Sign In for Pricing
View Details
PTTG1IP (NM_004339) Human Over-expression Lysate
LY401383 100 µg

PTTG1IP (NM_004339) Human Over-expression Lysate

Sign In for Pricing
View Details
Elk1 Antibody
8C10425-AAT 50 µg

Elk1 Antibody

Sign In for Pricing
View Details
Bovine Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit
RD-Tie1-b-01 96 Tests

Bovine Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit

Sign In for Pricing
View Details
Bovine Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit
RD-Tie1-b-02 48 Tests

Bovine Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details