Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF7IP2 Peptide - middle region

ATF7IP2 Peptide - middle region

Product Specifications

Product Name Alternative

MCAF2

UniProt

Q5U623

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243089.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPPAPLPELVDKTRDTLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Portable Refrigerator BPOR-106
BPOR-106 1 Unit

Portable Refrigerator BPOR-106

Sign In for Pricing
View Details
Tgfb1i1 Mouse Gene Knockout Kit (CRISPR)
KN517483 1 Kit

Tgfb1i1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CalreticuLin (CALR) (NM_004343) Human Over-expression Lysate
LY401384 100 µg

CalreticuLin (CALR) (NM_004343) Human Over-expression Lysate

Sign In for Pricing
View Details
GDF 9 (GDF9) (NM_001288827) Human Tagged ORF Clone
RG237749 10 µg

GDF 9 (GDF9) (NM_001288827) Human Tagged ORF Clone

Sign In for Pricing
View Details
Delta14,15-Algestone Acetophenide (Mixture of Diastereomers)
TRC-A189620-2.5MG 2.5 mg

Delta14,15-Algestone Acetophenide (Mixture of Diastereomers)

Sign In for Pricing
View Details
Human ENO4 activation kit by CRISPRa
GA117900 1 Kit

Human ENO4 activation kit by CRISPRa

Sign In for Pricing
View Details