Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBAC1 Peptide - C-terminal region

UBAC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GBDR1, UBADC1

UniProt

Q9BSL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057256.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAD antibody
70R-51460 100 ul

BAD antibody

Sign In for Pricing
View Details
Perfluoro (methyldecahydronaphthalene)
PC108359 1 Each

Perfluoro (methyldecahydronaphthalene)

Sign In for Pricing
View Details
Recombinant CD3E Monoclonal Antibody
AN301993L-01 50 µL

Recombinant CD3E Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD3E Monoclonal Antibody
AN301993L-02 100 µL

Recombinant CD3E Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS510641 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
STOX2 Protein Vector (Human) (pPM-C-HA)
45767021 500 ng

STOX2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details