Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERTAD3 Peptide - N-terminal region

SERTAD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RBT1

UniProt

Q9UJW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_037500.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sel1l3 AAV siRNA Pooled Vector
43327164 1.0 µg

Sel1l3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
S100B Protein (N-His, Human)
P521600 100 µg

S100B Protein (N-His, Human)

Sign In for Pricing
View Details
Olfr1221 Protein Vector (Mouse) (pPB-C-His)
PV208594 500 ng

Olfr1221 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-PTK7/CCK4 Antibody (Cofetuzumab)
F1517-5 5 mg

Anti-PTK7/CCK4 Antibody (Cofetuzumab)

Sign In for Pricing
View Details
RCBTB2 Polyclonal Antibody, Biotin Conjugated
A63309-100 100 µL

RCBTB2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
X-Glucoside 5-Bromo-4-Chloro-3-Indolyl-ß-D-Glucopyranoside For Molecular Biology 97.0%
998908-01 1 mg

X-Glucoside 5-Bromo-4-Chloro-3-Indolyl-ß-D-Glucopyranoside For Molecular Biology 97.0%

Sign In for Pricing
View Details