Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERTAD3 Peptide - N-terminal region

SERTAD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RBT1

UniProt

Q9UJW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_037500.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA1 Conjugated Antibody
orb1625965 100 µL

DEFA1 Conjugated Antibody

Sign In for Pricing
View Details
KT33B Polyclonal Antibody
MBS8529586-01 0.1 mg

KT33B Polyclonal Antibody

Sign In for Pricing
View Details
KT33B Polyclonal Antibody
MBS8529586-02 0.1 mL (AF635)

KT33B Polyclonal Antibody

Sign In for Pricing
View Details
KT33B Polyclonal Antibody
MBS8529586-03 0.1 mL (AF610)

KT33B Polyclonal Antibody

Sign In for Pricing
View Details
KT33B Polyclonal Antibody
MBS8529586-04 0.1 mL (AF405S)

KT33B Polyclonal Antibody

Sign In for Pricing
View Details
KT33B Polyclonal Antibody
MBS8529586-05 0.1 mL (AF405L)

KT33B Polyclonal Antibody

Sign In for Pricing
View Details