Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1I2 Peptide - middle region

DYNC1I2 Peptide - middle region

Product Specifications

Product Name Alternative

IC2, DNCI2

UniProt

O14576

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258714.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPEYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSL (Cathepsin L) BioAssayTM ELISA Kit (Human) discontinued
382556 96 Tests

CTSL (Cathepsin L) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
GALT Antibody [C15E2]
F3972-100uL 100 µL

GALT Antibody [C15E2]

Sign In for Pricing
View Details
SARS-CoV RBD recombinant protein (Arg306-Gln523)
PX-COV-P086-100 100 µg

SARS-CoV RBD recombinant protein (Arg306-Gln523)

Sign In for Pricing
View Details
Anti-Zebrafish SMARCB1a/b Antibody Picoband® PE Conjugated
AZQ5U379-PE 100 µg/Vial

Anti-Zebrafish SMARCB1a/b Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
ZNF7 (Zinc Finger Protein 7, HF.16, KOX4, zf30, Zinc Finger Protein HF.16, Zinc Finger Protein KOX4) (MaxLight 750) discontinued
135790-ML750 100 µL

ZNF7 (Zinc Finger Protein 7, HF.16, KOX4, zf30, Zinc Finger Protein HF.16, Zinc Finger Protein KOX4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MRPL33 Human Over-expression Lysate
orb1366578 20 µg

MRPL33 Human Over-expression Lysate

Sign In for Pricing
View Details