Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1I2 Peptide - middle region

DYNC1I2 Peptide - middle region

Product Specifications

Product Name Alternative

IC2, DNCI2

UniProt

Q13409

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258714.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T2R60 CRISPR Activation Plasmid (h2)
sc-415490-ACT-2 20 µg

T2R60 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
C6orf187 Human shRNA Plasmid Kit (Locus ID 221299)
TR319330 1 Kit

C6orf187 Human shRNA Plasmid Kit (Locus ID 221299)

Sign In for Pricing
View Details
CRYGB Antibody - middle region
OAAB11599-400UL 400 µL

CRYGB Antibody - middle region

Sign In for Pricing
View Details
Atf7ip2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4528308 1.0 µg DNA

Atf7ip2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Scarb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7107006 1.0 µg DNA

Scarb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
KU675
M12166-01 1 g

KU675

Sign In for Pricing
View Details