Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXD2 Peptide - middle region

EXD2 Peptide - middle region

Product Specifications

Product Name Alternative

EXDL2, C14orf114

UniProt

Q9NVH0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180289.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEVNGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAY 85-3934
9597-5 5 mg

BAY 85-3934

Sign In for Pricing
View Details
SEMA3A Protein, Human, Recombinant (His & Flag)
TMPJ-00383-01 5 µg

SEMA3A Protein, Human, Recombinant (His & Flag)

Sign In for Pricing
View Details
SEMA3A Protein, Human, Recombinant (His & Flag)
TMPJ-00383-02 10 µg

SEMA3A Protein, Human, Recombinant (His & Flag)

Sign In for Pricing
View Details
SEMA3A Protein, Human, Recombinant (His & Flag)
TMPJ-00383-03 20 µg

SEMA3A Protein, Human, Recombinant (His & Flag)

Sign In for Pricing
View Details
SEMA3A Protein, Human, Recombinant (His & Flag)
TMPJ-00383-04 50 µg

SEMA3A Protein, Human, Recombinant (His & Flag)

Sign In for Pricing
View Details
SEMA3A Protein, Human, Recombinant (His & Flag)
TMPJ-00383-05 100 µg

SEMA3A Protein, Human, Recombinant (His & Flag)

Sign In for Pricing
View Details