Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXD2 Peptide - middle region

EXD2 Peptide - middle region

Product Specifications

Product Name Alternative

EXDL2, C14orf114

UniProt

Q9NVH0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180289.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEVNGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit ERK2 Antibody
orb1527304-01 10 µL

Rabbit ERK2 Antibody

Sign In for Pricing
View Details
Rabbit ERK2 Antibody
orb1527304-02 100 µL

Rabbit ERK2 Antibody

Sign In for Pricing
View Details
Sartorius Filter Minisart HY 25mmx0.2um
FIL6722 10 / PCK

Sartorius Filter Minisart HY 25mmx0.2um

Sign In for Pricing
View Details
Rabbit anti-CHERP Antibody
MBS4508636-01 0.05 mL

Rabbit anti-CHERP Antibody

Sign In for Pricing
View Details
Rabbit anti-CHERP Antibody
MBS4508636-02 0.1 mL

Rabbit anti-CHERP Antibody

Sign In for Pricing
View Details
Rabbit anti-CHERP Antibody
MBS4508636-03 5x 0.1 mL

Rabbit anti-CHERP Antibody

Sign In for Pricing
View Details