Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF280D Peptide - middle region

ZNF280D Peptide - middle region

Product Specifications

Product Name Alternative

SUHW4, ZNF634

UniProt

Q6N043

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001002843.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FQLQCHIESTHTPHEFSTICKICELSFETEHVLLQHMKDNHKPGEMPYVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit
ELK7721-01 48 Tests

Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit

Sign In for Pricing
View Details
Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit
ELK7721-02 96 Tests

Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit

Sign In for Pricing
View Details
Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit
ELK7721-03 5x 96 Tests

Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-RUBIC/RUBCN Polyclonal Antibody
PAV3501 100 μL

Rabbit Anti-RUBIC/RUBCN Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal SOD2/Mn-SOD Antibody (012)
NBP2-90139-50ul 50 µL

Rabbit Monoclonal SOD2/Mn-SOD Antibody (012)

Sign In for Pricing
View Details
BC005624 Protein Vector (Mouse) (pPM-C-HA)
PV158472 500 ng

BC005624 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details