Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Peptide - N-terminal region

ZNF692 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AREBP, Zfp692

UniProt

Q9BU19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129508.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RREKRRQLDARRSKCRIRLGGHMEQWCLLKERLGFSLHSQLAKFLLDRYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCTAIRE1 (CDK16) Human Knockdown Lysate
LY300102 100 µg

PCTAIRE1 (CDK16) Human Knockdown Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS710869 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
SH2D2A Rabbit Polyclonal Antibody
TA381453 100 µL

SH2D2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FKBP52 (FKBP4) Rabbit Polyclonal Antibody
TA362727 100 µL

FKBP52 (FKBP4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details