Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Peptide - N-terminal region

ZNF692 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AREBP, Zfp692

UniProt

Q9BU19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129508.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RREKRRQLDARRSKCRIRLGGHMEQWCLLKERLGFSLHSQLAKFLLDRYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-)-Estra-4,9-diene-3,17-dione
TRC-E668550-5G 5 g

(-)-Estra-4,9-diene-3,17-dione

Sign In for Pricing
View Details
Human ZCCHC18 activation kit by CRISPRa
GA118731 1 Kit

Human ZCCHC18 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human TXNDC12/ERp18 Protein (His Tag)
PKSH033106-01 10 µg

Recombinant Human TXNDC12/ERp18 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TXNDC12/ERp18 Protein (His Tag)
PKSH033106-02 50 µg

Recombinant Human TXNDC12/ERp18 Protein (His Tag)

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF740 conjugate, 0.1mg/mL
BNC742037-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caspase-7 (CASP7) (NM_001227) Human Over-expression Lysate
LY429055 100 µg

Caspase-7 (CASP7) (NM_001227) Human Over-expression Lysate

Sign In for Pricing
View Details