Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD17 Peptide - middle region

KCTD17 Peptide - middle region

Product Specifications

UniProt

Q8N5Z5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269613.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEEVEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WDR51B Antibody
MBS8307730-01 0.03 mL

Anti-WDR51B Antibody

Sign In for Pricing
View Details
Anti-WDR51B Antibody
MBS8307730-02 0.05 mL

Anti-WDR51B Antibody

Sign In for Pricing
View Details
Anti-WDR51B Antibody
MBS8307730-03 0.1 mL

Anti-WDR51B Antibody

Sign In for Pricing
View Details
Anti-WDR51B Antibody
MBS8307730-04 0.2 mL

Anti-WDR51B Antibody

Sign In for Pricing
View Details
Anti-WDR51B Antibody
MBS8307730-05 5x 0.2 mL

Anti-WDR51B Antibody

Sign In for Pricing
View Details
Mouse Stk39 (Serine/Threonine Protein Kinase 39) ELISA Kit
FY-EM5144 96 Well

Mouse Stk39 (Serine/Threonine Protein Kinase 39) ELISA Kit

Sign In for Pricing
View Details