Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMG9 Peptide - N-terminal region

SMG9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C19orf61, F17127_1

UniProt

Q9H0W8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061981.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQPGLYGIERRRRWKEPGSGGPQNLSGPGGRERDYIAPWERERRDASEET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Strept. Avidin FITC Colloidal Gold,  5nm
FGA-02-5 1 mL

Strept. Avidin FITC Colloidal Gold, 5nm

Sign In for Pricing
View Details
HPRT Recombinant Rabbit monoclonal Antibody
HA750452 100 µL

HPRT Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse REG3D Protein (His Tag)
PKSM040625 100 µg

Recombinant Mouse REG3D Protein (His Tag)

Sign In for Pricing
View Details
Recombinant MYL2 Antibody
RC-15278-01 50 μL

Recombinant MYL2 Antibody

Sign In for Pricing
View Details
Recombinant MYL2 Antibody
RC-15278-02 100 µL

Recombinant MYL2 Antibody

Sign In for Pricing
View Details
Recombinant MYL2 Antibody
RC-15278-03 1 mL

Recombinant MYL2 Antibody

Sign In for Pricing
View Details