MPPE1 Peptide - middle region
MPPE1 Peptide - middle region
Product Specifications
Product Name Alternative
PGAP5
UniProt
Q53F39
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001229833.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLVLSGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1142816-01 0.02 mg (E-Coli)
Recombinant Aeropyrum pernix DNA repair and recombination protein radA (radA)
Sign In for Pricing
View Details MBS1142816-02 0.02 mg (Yeast)
Recombinant Aeropyrum pernix DNA repair and recombination protein radA (radA)
Sign In for Pricing
View Details MBS1142816-03 0.1 mg (E-Coli)
Recombinant Aeropyrum pernix DNA repair and recombination protein radA (radA)
Sign In for Pricing
View Details MBS1142816-04 0.1 mg (Yeast)
Recombinant Aeropyrum pernix DNA repair and recombination protein radA (radA)
Sign In for Pricing
View Details MBS1142816-05 0.02 mg (Baculovirus)
Recombinant Aeropyrum pernix DNA repair and recombination protein radA (radA)
Sign In for Pricing
View Details MBS1142816-06 0.02 mg (Mammalian-Cell)
Recombinant Aeropyrum pernix DNA repair and recombination protein radA (radA)
Sign In for Pricing
View Details